CCL8/MCP-2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24871-20UL
100 ul
£336.00
A24871-100UL
500 ul
£1258.00
A24871-500UL
1000 ul
£2228.00
A24871-1000UL
About this Product
- SKU:
- A24871
- Additional Names:
- C-C motif chemokine 8|CCL8|CCL8/MCP-2|HC14|MCP-2|MCP2|SCYA10|SCYA8
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 11kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24871
