SFTPA1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24870-20UL
100 ug
£336.00
A24870-100UG
500 ul
£1258.00
A24870-500UL
1000 ul
£2228.00
A24870-1000UL
About this Product
- SKU:
- A24870
- Additional Names:
- COLEC4|ILD1|PSAP|PSP-A|PSPA|SFTP1|SFTPA1|SFTPA1B|SP-A|SP-A1|SP-A1 beta|SP-A1 delta|SP-A1 epsilon|SP-A1 gamma|SPA|SPA1
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30-38kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- PAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24870
