Ku80 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24867-20UL
100 ul
£336.00
A24867-100UL
500 ul
£1258.00
A24867-500UL
1000 ul
£2228.00
A24867-1000UL
About this Product
- SKU:
- A24867
- Additional Names:
- CTC85|CTCBF|Ku80|Ku86
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable several functions, including nucleic acid binding activity; protein C-terminus binding activity; and ubiquitin protein ligase binding activity. Predicted to contribute to 5'-deoxyribose-5-phosphate lyase activity and double-stranded telomeric DNA binding activity. Acts upstream of or within several processes, including cellular response to leukemia inhibitory factor; hematopoietic stem cell differentiation; and positive regulation of neurogenesis. Located in cytoplasm and nucleus. Is expressed in thymus primordium. Human ortholog(s) of this gene implicated in chronic obstructive pulmonary disease and multiple myeloma. Orthologous to human XRCC5 (X-ray repair cross complementing 5).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 83 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- IKKKNQVTAQDVFQDNHEEGPAAKKYKTEKEEDHISISSLAEGNITKVGSVNPVENFRFLVRQKIASFEEASLQLISHIEQFLDTNETLYFMKSMDCIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPGSSITAEEATKFLAPKDKAKEDTTGPEEAGDVDDLLDMI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24867
