SYT1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24840-20UL
100 ul
£336.00
A24840-100UL
500 ul
£1258.00
A24840-500UL
1000 ul
£2228.00
A24840-1000UL
About this Product
- SKU:
- A24840
- Additional Names:
- P65|SVP65|synaptotagmin-1|SYT|SYT1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin-1 participates in triggering neurotransmitter release at the synapse (Fernandez-Chacon et al., 2001 [PubMed 11242035]).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 60kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24840
