[KD Validated] MRPS7 Rabbit polyclonal antibody
Product Sizes
20 ul
£164.00
A24774-20UL
100 ul
£342.00
A24774-100UL
About this Product
- SKU:
- A24774
- Additional Names:
- bMRP27a|mitochondrial ribosomal protein S7|MRP-S|MRP-S7|MRPS7|RP-S7|RPMS7|S7mt
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 28kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- EFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24774
