ABflo[R] 488 Rabbit anti-Mouse CD124/IL-4RA Alpha monoclonal antibody
Product Sizes
100 tests
£181.00
A24723-100TESTS
200 tests
£283.00
A24723-200TESTS
500 tests
£419.00
A24723-500TESTS
About this Product
- SKU:
- A24723
- Additional Names:
- CD124|Il4r
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 87kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24723








