ABflo[R] 594 Rabbit anti-Human CD35 monoclonal antibody
Product Sizes
10 tests
£ POA
A24699-10TESTS
100 tests
£259.00
A24699-100TESTS
200 tests
£390.00
A24699-200TESTS
500 tests
£592.00
A24699-500TESTS
About this Product
- SKU:
- A24699
- Additional Names:
- C3BR|C4BR|CD35|complement receptor type 1|CR1|KN
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Complement receptor type 1 (CR1/CD35) is a type I transmembrane glycoprotein that is expressed on the surface of B cells, neutrophils, monocytes, and renal podocytes. As a component of the host's innate immune system, CR1/CD35 expressed on neutrophils and monocytes binds to ligands coated with complement opsonins C3b and C4b, thereby promoting phagocytosis and pro-inflammatory cytokine production. CR1/CD35 also participates in negative regulation of the complement cascade through its ability to promote dissociation of C3 and C5 convertases and by serving as one of multiple cofactors for factor-I-mediated cleavage and inactivation of C3b and C4b.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 223kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24699


