ABflo[R] 488 Rabbit anti-Human CD185/CXCR5 monoclonal antibody
Product Sizes
10 tests
£ POA
A24676-10TESTS
100 tests
£324.00
A24676-100TESTS
200 tests
£509.00
A24676-200TESTS
500 tests
£782.00
A24676-500TESTS
About this Product
- SKU:
- A24676
- Additional Names:
- BLR1|CD185|MDR15
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24676
