CDKN2A/p19ARF Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A24653-5UL
20 ul
£164.00
A24653-20UL
100 ul
£342.00
A24653-100UL
500 ul
£1532.00
A24653-500UL
1000 ul
£2704.00
A24653-1000UL
About this Product
- SKU:
- A24653
- Additional Names:
- Arf|ARF-INK4a|CDKN2A/p19ARF|INK4a-ARF|Ink4a/Arf|MTS1|p16|p16(INK4a)|p16INK4a|p19<ARF>|p19ARF|Pctr1
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables MDM2/MDM4 family protein binding activity; enzyme inhibitor activity; and protein N-terminus binding activity. Involved in several processes, including negative regulation of lymphocyte proliferation; positive regulation of apoptotic process; and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including negative regulation of cellular protein metabolic process; negative regulation of mammary gland epithelial cell proliferation; and positive regulation of apoptotic process involved in mammary gland involution. Located in cytoplasm and granular component. Part of protein-containing complex. Is expressed in several structures, including bone marrow; central nervous system; dorsal root ganglion; eye; and testis. Human ortholog(s) of this gene implicated in several diseases, including breast cancer (multiple); carcinoma (multiple); hematologic cancer (multiple); melanoma (multiple); and nervous system cancer (multiple). Orthologous to human CDKN2A (cyclin dependent kinase inhibitor 2A).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 21 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24653
