ABflo[R] 647 Rabbit anti-Human CD335/NKp46 monoclonal antibody
Product Sizes
10 tests
£ POA
A24625-10TESTS
100 tests
£324.00
A24625-100TESTS
200 tests
£509.00
A24625-200TESTS
500 tests
£782.00
A24625-500TESTS
About this Product
- SKU:
- A24625
- Additional Names:
- CD335|LY94|natural cytotoxicity triggering receptor 1|NCR1|NK-p46|NKP46
- Application:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- The natural cytotoxic receptor (NCR) family includes NCR1 (NKp46/CD335), NCR2 (NKp44/CD336), and NCR3 (NKp30/CD337). They are type I single Transmembrane protein belonging to the immunoglobulin (Ig) superfamily. Various pathogenic and host coding molecules have been identified as ligands for NCR. They were initially discovered through their ability to induce cytotoxicity of natural killer (NK) cells to tumor cells in vitro, and animal models have shown that NCR plays a role in tumor monitoring, viral infection, and pregnancy in vivo. NCR1/NKP46 is considered a universal marker of NK cells, and recent studies have found that it is also expressed by other cells, such as the first group of natural lymphocytes (ILC1), a subgroup of the third group of ILC (NCR+ILC3), and G GammaD Delta T cells. NCR1/NKp46 is also expressed in some malignant NK cells, natural killer T (NKT) cells and T-cell lymphoma, and is considered as a diagnostic marker and therapeutic target for them. The cross-linking of NCR1/NKp46 with antibodies can activate NK cells, which has been studied as a promising therapeutic pathway.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 21kDa/22kDa/23kDa/32kDa/34kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24625


