PE Rabbit anti-Human Integrin B Beta5/ITGB5 monoclonal antibody
Product Sizes
10 tests
£ POA
A24597-10TESTS
100 tests
£324.00
A24597-100TESTS
200 tests
£509.00
A24597-200TESTS
500 tests
£782.00
A24597-500TESTS
About this Product
- SKU:
- A24597
- Additional Names:
- integrin beta-5|ITGB5
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- R-PE
- Extra Details:
- I Iotantegrins, heterodimeric trans-membrane matrix receptors, are mainly involved in the signal transduction and attachments to extra cellular matrix (ECM). In ECM they act as a mediator of cell adhesion. In human, at least 18 A Alpha and eight B Beta subunits have been found. ITGB5 (integrin subunit B Beta 5) helps in facilitation of cancer cell migration, anchorage-independent growth and tumor angiogenesis. Integrin is activated by G-protein-coupled receptors, resulting in the phosphorylation of cytoplasmic domain of the B Beta subunit. The coupled A Alpha and B Beta cytoplasmic tails are responsible for maintaining integrin in inactive state.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24597


