ABflo[R] 488 Rabbit anti-Human CD158b/KIR2DL2/KIR2DL3 monoclonal antibody
Product Sizes
100 tests
£259.00
A24574-100TESTS
200 tests
£390.00
A24574-200TESTS
500 tests
£592.00
A24574-500TESTS
About this Product
- SKU:
- A24574
- Additional Names:
- CD158b|CD158B2|GL183|killer cell immunoglobulin-like receptor 2DL3|KIR-023GB|KIR-K7b|KIR-K7c|KIR2DL3|KIR2DS5|KIRCL23|NKAT|NKAT2|NKAT2A|NKAT2B|p58
- Application:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 27kDa/37kDa/38kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24574








