Mouse PlGF Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24547-20UL
100 ul
£336.00
A24547-100UL
500 ul
£1258.00
A24547-500UL
1000 ul
£2228.00
A24547-1000UL
About this Product
- SKU:
- A24547
- Additional Names:
- Mouse PlGF|PIGF|Plgf
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable identical protein binding activity; receptor ligand activity; and vascular endothelial growth factor receptor binding activity. Acts upstream of or within branching involved in ureteric bud morphogenesis and regulation of morphogenesis of a branching structure. Located in extracellular space. Is expressed in several structures, including brain; gut gland; musculature; reproductive system; and urinary system. Human ortholog(s) of this gene implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Orthologous to human PGF (placental growth factor).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24547
