CD53 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24527-20UL
100 ul
£336.00
A24527-100UL
500 ul
£1258.00
A24527-500UL
1000 ul
£2228.00
A24527-1000UL
About this Product
- SKU:
- A24527
- Additional Names:
- CD53|Ox-44|Tspan25
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable identical protein binding activity. Involved in positive regulation of myoblast fusion. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD53 (CD53 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35-45kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24527
