POLE4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24516-20UL
100 ul
£336.00
A24516-100UL
500 ul
£1258.00
A24516-500UL
1000 ul
£2228.00
A24516-1000UL
About this Product
- SKU:
- A24516
- Additional Names:
- DNA polymerase epsilon subunit 4|p12|POLE4|YHHQ1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 15kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24516
