TNF RII/TNFRSF1B/CD120b Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24513-20UL
100 ul
£336.00
A24513-100UL
500 ul
£1258.00
A24513-500UL
1000 ul
£2228.00
A24513-1000UL
About this Product
- SKU:
- A24513
- Additional Names:
- CD120b|p75|TNF RII/TNFRSF1B/CD120b|TNF-alphaR2|TNF-R-II|TNF-R2|TNF-R75|TNFalpha-R2|TNFBR|Tnfr-1|Tnfr2|TNFR80|TNFRII
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including negative regulation of extracellular matrix constituent secretion; regulation of nervous system development; and semi-lunar valve development. Acts upstream of or within several processes, including RNA destabilization; apoptotic signaling pathway; and negative regulation of inflammatory response. Located in membrane raft. Is expressed in several structures, including blood; dorsal aorta; extraembryonic component; genitourinary system; and liver. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism; acne; bone disease (multiple); glomerulonephritis (multiple); and lung disease (multiple). Orthologous to human TNFRSF1B (TNF receptor superfamily member 1B).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24513
