MAdCAM-1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24489-20UL
100 ul
£336.00
A24489-100UL
500 ul
£1258.00
A24489-500UL
1000 ul
£2228.00
A24489-1000UL
About this Product
- SKU:
- A24489
- Additional Names:
- MAdCAM-1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable integrin binding activity involved in cell-matrix adhesion. Acts upstream of or within keratinocyte differentiation and leukocyte migration. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in eyelid; hair follicle; and hemolymphoid system. Orthologous to human MADCAM1 (mucosal vascular addressin cell adhesion molecule 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 60kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24489
