CD81 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24484-20UL
100 ul
£336.00
A24484-100UL
500 ul
£1258.00
A24484-500UL
1000 ul
£2228.00
A24484-1000UL
About this Product
- SKU:
- A24484
- Additional Names:
- CD81|Tapa-1|Tapa1|Tspan28
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable cholesterol binding activity; signaling receptor binding activity; and virus receptor activity. Involved in several processes, including cellular response to low-density lipoprotein particle stimulus; positive regulation of immune response; and syncytium formation by plasma membrane fusion. Acts upstream of or within regulation of cell motility. Located in membrane. Is expressed in several structures, including alimentary system; extraembryonic component; genitourinary system; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD81 (CD81 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24484
