ABflo[R] 594 Rabbit anti-Human Podoplanin monoclonal antibody
Product Sizes
10 tests
£ POA
A24410-10TESTS
100 tests
£324.00
A24410-100TESTS
200 tests
£509.00
A24410-200TESTS
500 tests
£782.00
A24410-500TESTS
About this Product
- SKU:
- A24410
- Additional Names:
- AGGRUS|GP36|Gp38|GP40|HT1A-1|OTS8|PA2.26|PDPN|podoplanin|T1A|T1A-2|T1A2|TI1A
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 12kDa/16kDa/18kDa/24kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24410
