ABflo[R] 594 Rabbit anti-Mouse Ly-6A/E (Sca-1) monoclonal antibody
Product Sizes
100 tests
£181.00
A24400-100TESTS
200 tests
£283.00
A24400-200TESTS
500 tests
£419.00
A24400-500TESTS
About this Product
- SKU:
- A24400
- Additional Names:
- Ly-6A.2, Ly-6A/E, Ly-6E.1, Sca-1, Sca1, TAP
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 114kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24400
