ABflo[R] 594 Rabbit anti-Mouse CD262/DR5/TRAILR2 monoclonal antibody
Product Sizes
10 tests
£ POA
A24376-10TESTS
100 tests
£122.00
A24376-100TESTS
200 tests
£169.00
A24376-200TESTS
500 tests
£241.00
A24376-500TESTS
About this Product
- SKU:
- A24376
- Additional Names:
- DR5|KILLER|Ly98|MK|TRAILR2|TRICK2A|TRICK2B|TRICKB
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Predicted to enable TRAIL receptor activity; identical protein binding activity; and protease binding activity. Predicted to be involved in TRAIL-activated apoptotic signaling pathway and positive regulation of apoptotic process. Predicted to act upstream of or within apoptotic process and regulation of apoptotic process. Predicted to be located in Golgi apparatus; cytosol; and membrane raft. Predicted to be active in cell surface and plasma membrane. Is expressed in bladder; liver; renal vasculature; urethra of female; and urethra of male. Human ortholog(s) of this gene implicated in carcinoma (multiple); cervical cancer; hematologic cancer (multiple); and urinary bladder cancer. Orthologous to several human genes including TNFRSF10A (TNF receptor superfamily member 10a).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24376


