Fos B Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A24339-5UL
20 ul
£164.00
A24339-20UL
100 ul
£342.00
A24339-100UL
500 ul
£1532.00
A24339-500UL
1000 ul
£2704.00
A24339-1000UL
About this Product
- SKU:
- A24339
- Additional Names:
- AP-1|Fos B|G0S3|GOS3|GOSB
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kDa/48kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24339
