ABflo[R] 594 Rabbit anti-Human CD79a monoclonal antibody
Product Sizes
100 tests
£259.00
A24330-100TESTS
200 tests
£390.00
A24330-200TESTS
500 tests
£592.00
A24330-500TESTS
About this Product
- SKU:
- A24330
- Additional Names:
- CD79A|CD79a molecule|IGA|MB-1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20kDa/25kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24330
