NCR3 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A24295-20UL
100 ul
£342.00
A24295-100UL
About this Product
- SKU:
- A24295
- Additional Names:
- 1C7|CD337|LY117|MALS|natural cytotoxicity triggering receptor 3|NCR3|NKp30
- Application:
- ELISA, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24295










