PP2A-B55A Alpha/PR55A Alpha/PPP2R2A Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A24261-5UL
20 ul
£164.00
A24261-20UL
100 ul
£342.00
A24261-100UL
500 ul
£1532.00
A24261-500UL
1000 ul
£2704.00
A24261-1000UL
About this Product
- SKU:
- A24261
- Additional Names:
- B55A|B55ALPHA|PP2A-B55A Alpha/PR55A Alpha/PPP2R2A|PR52A|PR55A|PR55alpha
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants have been described.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 52kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- EKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24261
