ABflo[R] 488 Rabbit anti-Human IL-1B Beta monoclonal antibody
Product Sizes
10 tests
£ POA
A24244-10TESTS
100 tests
£259.00
A24244-100TESTS
200 tests
£390.00
A24244-200TESTS
500 tests
£592.00
A24244-500TESTS
About this Product
- SKU:
- A24244
- Additional Names:
- IL-1|IL1-BETA|IL1B|IL1F2|interleukin-1 beta
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24244


