Asymmetric DiMethyl-Histone H3-R17 Rabbit polyclonal antibody
Product Sizes
20 ul
£164.00
A2421-20UL
100 ul
£342.00
A2421-100UL
About this Product
- SKU:
- A2421
- Additional Names:
- Asymmetric DiMethyl-Histone H3-R17|H3/j|H3C1|H3C10|H3C11|H3C2|H3C3|H3C4|H3C6|H3C7|H3C8|H3FJ|HIST1H3J
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 15kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Other Species, Rat
- Sequence:
- MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2421










