Histone H2B (testis specific) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A24166-5UL
20 ul
£164.00
A24166-20UL
100 ul
£342.00
A24166-100UL
500 ul
£1532.00
A24166-500UL
1000 ul
£2704.00
A24166-1000UL
About this Product
- SKU:
- A24166
- Additional Names:
- bA317E16.3|H2BFU|HIST1H2BA|Histone H2B (testis specific)?|hTSH2B|STBP|TH2B|TSH2B|TSH2B.1
- Application:
- ChIP, ELISA, IHC-Paraffin, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 17kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Other Species, Rat
- Sequence:
- MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24166
