ASC/TMS1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A24165-5UL
20 ul
£164.00
A24165-20UL
100 ul
£342.00
A24165-100UL
500 ul
£1532.00
A24165-500UL
1000 ul
£2704.00
A24165-1000UL
About this Product
- SKU:
- A24165
- Additional Names:
- 9130417A21Rik|Asc|ASC/TMS1|CARD5|masc|TMS-1|TNS1
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables identical protein binding activity and protein dimerization activity. Involved in several processes, including activation of cysteine-type endopeptidase activity; positive regulation of cytokine production; and regulation of defense response. Acts upstream of or within several processes, including defense response to Gram-positive bacterium; positive regulation of macromolecule metabolic process; and regulation of autophagy. Located in cytosol; extracellular region; and nucleus. Part of inflammasome complex. Is expressed in several structures, including alimentary system; brain; heart; hemolymphoid system gland; and urinary system. Orthologous to human PYCARD (PYD and CARD domain containing).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 17kDa/24kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYLESYGLELTMTVLRDMGLQELAEQLQTTKEESG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24165
