ABflo[R] 594 Rabbit anti-Mouse CD138/Syndecan-1 monoclonal antibody
Product Sizes
10 tests
£ POA
A24155-10TESTS
100 tests
£259.00
A24155-100TESTS
200 tests
£390.00
A24155-200TESTS
500 tests
£592.00
A24155-500TESTS
About this Product
- SKU:
- A24155
- Additional Names:
- CD138|Sstn|syn-1|Synd|Synd1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Predicted to enable identical protein binding activity and protein C-terminus binding activity. Involved in myoblast development. Acts upstream of or within canonical Wnt signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; egg cylinder; sensory organ; skin; and urinary system. Orthologous to human SDC1 (syndecan 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 33kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKEVLG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24155
