ABflo[R] 488 Rabbit anti-Mouse CD80/B7-1 monoclonal antibody
Product Sizes
10 tests
£ POA
A23965-10TESTS
100 tests
£181.00
A23965-100TESTS
200 tests
£283.00
A23965-200TESTS
500 tests
£419.00
A23965-500TESTS
About this Product
- SKU:
- A23965
- Additional Names:
- B71|Cd28l|Ly-53|Ly53|MIC17|TSA1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Predicted to enable coreceptor activity. Acts upstream of or within T cell costimulation; cellular response to lipopolysaccharide; and positive regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is expressed in heart ventricle and skin. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human CD80 (CD80 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 34kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23965
