HSP40 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A23957-5UL
20 ul
£164.00
A23957-20UL
100 ul
£342.00
A23957-100UL
500 ul
£1532.00
A23957-500UL
1000 ul
£2704.00
A23957-1000UL
About this Product
- SKU:
- A23957
- Additional Names:
- dnaJ homolog subfamily B member 1|DNAJB1|Hdj1|Hsp40|HSPF1|RSPH16B|Sis1
- Application:
- ELISA, Flow Cytometry, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 40kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23957
