CD3d Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23883-20UL
100 ul
£336.00
A23883-100UL
500 ul
£1258.00
A23883-500UL
1000 ul
£2228.00
A23883-1000UL
About this Product
- SKU:
- A23883
- Additional Names:
- CD3d|T3d
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Involved in positive thymic T cell selection. Part of alpha-beta T cell receptor complex. Is expressed in thymus primordium. Human ortholog(s) of this gene implicated in immunodeficiency 19 and severe combined immunodeficiency. Orthologous to human CD3D (CD3d molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- VLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIAT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23883
