CD352/SLAMF6 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A23833-20UL
100 ul
£342.00
A23833-100UL
About this Product
- SKU:
- A23833
- Additional Names:
- CD352|CD352/SLAMF6|KALI|KALIb|Ly108|NTB-A|NTBA|SF2000|SLAM family member 6|SLAMF6
- Application:
- ELISA, Flow Cytometry, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 24 kDa/37 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23833










