ABflo[R] 594 Rabbit anti-Mouse CD97 monoclonal antibody
Product Sizes
10 tests
£ POA
A23823-10TESTS
100 tests
£259.00
A23823-100TESTS
200 tests
£390.00
A23823-200TESTS
500 tests
£592.00
A23823-500TESTS
About this Product
- SKU:
- A23823
- Additional Names:
- Cd97|TM7LN1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Predicted to enable G protein-coupled receptor activity and chondroitin sulfate binding activity. Acts upstream of or within positive regulation of synapse assembly. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; eye; genitourinary system; gut; and immune system. Human ortholog(s) of this gene implicated in vibratory urticaria. Orthologous to several human genes including ADGRE5 (adhesion G protein-coupled receptor E5).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 90KDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQASVNTGTTPVPSRIHTVTTAPGNLPEQTTTVHQTQMGDSEERTPKDVNECISGQNHCHQSTHCINKLGGYSCICRQGWKPVPGSPNGPVSTVCEDVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23823


