Fibroblast activation protein-A Alpha (FAP) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A23789-5UL
20 ul
£164.00
A23789-20UL
100 ul
£342.00
A23789-100UL
500 ul
£1532.00
A23789-500UL
1000 ul
£2704.00
A23789-1000UL
About this Product
- SKU:
- A23789
- Additional Names:
- DPPIV|FAP|FAPA|FAPalpha|Fibroblast activation protein-A Alpha (FAP)|prolyl endopeptidase FAP|SIMP
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 95 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- SSNEFEEYPGRRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEENKELENALKNIQLPKEEIKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23789
