TEAD4 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A23774-5UL
20 ul
£164.00
A23774-20UL
100 ul
£342.00
A23774-100UL
500 ul
£1532.00
A23774-500UL
1000 ul
£2704.00
A23774-1000UL
About this Product
- SKU:
- A23774
- Additional Names:
- EFTR-2|hRTEF-1B|RTEF1|TCF13L1|TEA domain transcription factor 4|TEAD4|TEF-3|TEF3|TEFR-1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23774
