ATP6V0C Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A23757-20UL
100 ul
£342.00
A23757-100UL
About this Product
- SKU:
- A23757
- Additional Names:
- ATP6C|ATP6L|ATP6V0C|ATPase H+ transporting V0 subunit c|ATPL|VATL|Vma3|VPPC
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 15kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23757




