[KD Validated] COX7A2L Rabbit polyclonal antibody
Product Sizes
5 ul
£ POA
A23681-5UL
20 ul
£164.00
A23681-20UL
100 ul
£342.00
A23681-100UL
500 ul
£1532.00
A23681-500UL
1000 ul
£2704.00
A23681-1000UL
About this Product
- SKU:
- A23681
- Additional Names:
- [KD Validated] COX7A2L|COX7AR|COX7RP|EB1|SCAF1|SCAFI|SIG81
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23681
