Ly-6A/E (Sca-1) Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23672-20UL
100 ul
£336.00
A23672-100UL
500 ul
£1258.00
A23672-500UL
1000 ul
£2228.00
A23672-1000UL
About this Product
- SKU:
- A23672
- Additional Names:
- Ly-6A.2|Ly-6A/E|Ly-6A/E (Sca-1)|Ly-6E.1|Sca-1|Sca1|TAP
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 15kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23672
