IL22 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23665-20UL
100 ul
£336.00
A23665-100UL
500 ul
£1258.00
A23665-500UL
1000 ul
£2228.00
A23665-1000UL
About this Product
- SKU:
- A23665
- Additional Names:
- If2b1|IL-22|IL-22a|IL22|Iltif|ILTIFa
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable cytokine activity. Acts upstream of or within several processes, including negative regulation of inflammatory response; reactive oxygen species metabolic process; and regulation of tyrosine phosphorylation of STAT protein. Predicted to be located in extracellular space. Is expressed in retina and skin. Used to study liposarcoma. Human ortholog(s) of this gene implicated in asthma. Orthologous to human IL22 (interleukin 22).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 16kDa/18kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23665
