TriMethyl-Histone H3-K36 Rabbit polyclonal antibody
Product Sizes
20 ul
£164.00
A2366-20UL
100 ul
£342.00
A2366-100UL
About this Product
- SKU:
- A2366
- Additional Names:
- H3.4|H3/g|H3C16|H3FT|H3t|HIST3H3|TriMethyl-Histone H3-K36
- Application:
- ChIP, Dot Blot, ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 15 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Other Species, Rat
- Sequence:
- MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2366










