MAPT Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23656-20UL
100 ul
£336.00
A23656-100UL
500 ul
£1258.00
A23656-500UL
1000 ul
£2228.00
A23656-1000UL
About this Product
- SKU:
- A23656
- Additional Names:
- MAPT|Mtapt|PHF-tau|Tau
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables DNA binding activity; microtubule binding activity; and protein kinase binding activity. Involved in negative regulation of tubulin deacetylation; regulation of cellular response to heat; and regulation of response to DNA damage stimulus. Acts upstream of or within several processes, including adult walking behavior; generation of neurons; and transport along microtubule. Located in several cellular components, including cytoskeleton; glial cell projection; and postsynaptic density. Is expressed in several structures, including gut; nervous system; sensory organ; smooth muscle tissue; and urinary system. Used to study Alzheimer's disease. Human ortholog(s) of this gene implicated in dementia (multiple); neurodegenerative disease (multiple); progressive supranuclear palsy; and temporal lobe epilepsy. Orthologous to human MAPT (microtubule associated protein tau).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50-80 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- DPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTPNQEDQAAGHVTQARVASKDRTGNDEKKAKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23656
