CD335 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23655-20UL
100 ul
£336.00
A23655-100UL
500 ul
£1258.00
A23655-500UL
1000 ul
£2228.00
A23655-1000UL
About this Product
- SKU:
- A23655
- Additional Names:
- CD335|Ly94|NKp46
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Acts upstream of or within defense response to virus and detection of virus. Located in cell surface. Orthologous to human NCR1 (natural cytotoxicity triggering receptor 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 46kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPQPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23655
