CD119 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23652-20UL
100 ul
£336.00
A23652-100UL
500 ul
£1258.00
A23652-500UL
1000 ul
£2228.00
A23652-1000UL
About this Product
- SKU:
- A23652
- Additional Names:
- CD119|Ifgr|IFN-gammaR|Ifngr|Nktar
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable cytokine receptor activity. Involved in several processes, including astrocyte activation; negative regulation of amyloid-beta clearance; and positive regulation of macromolecule metabolic process. Acts upstream of or within defense response to virus. Predicted to be located in several cellular components, including dendrite; endoplasmic reticulum; and postsynaptic density. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system; cerebral cortex; cranium; female reproductive system; and liver. Used to study osteoporosis. Human ortholog(s) of this gene implicated in asthma; hepatitis B; immunodeficiency 27A; immunodeficiency 27B; and tuberculosis. Orthologous to human IFNGR1 (interferon gamma receptor 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 70-95kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23652
