Hmox1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23650-20UL
100 ul
£336.00
A23650-100UL
500 ul
£1258.00
A23650-500UL
1000 ul
£2228.00
A23650-1000UL
About this Product
- SKU:
- A23650
- Additional Names:
- D8Wsu38e|Hemox|Hmox|Hmox1|HO-1|HO1|Hsp32
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable several functions, including heme binding activity; heme oxygenase (decyclizing) activity; and protein homodimerization activity. Acts upstream of or within several processes, including cellular response to cisplatin; cellular response to metal ion; and regulation of macroautophagy. Located in nucleus. Is expressed in several structures, including alimentary system; central nervous system; early conceptus; genitourinary system; and sensory organ. Used to study hemochromatosis and malaria. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); factor VIII deficiency; lung disease (multiple); and sickle cell anemia. Orthologous to human HMOX1 (heme oxygenase 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 30kDa/35kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- ERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A23650
