Human IgG3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A23641-20UL
100 ul
£336.00
A23641-100UL
500 ul
£1258.00
A23641-500UL
1000 ul
£2228.00
A23641-1000UL
About this Product
- SKU:
- A23641
- Additional Names:
- Human IgG3|IgG3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in retina homeostasis. Located in blood microparticle and extracellular exosome.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 68kDa/55kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- TYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Secondary Antibodies
- Manufacturer's Data Sheet:A23641
