CD2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A23527-5UL
20 ul
£164.00
A23527-20UL
100 ul
£342.00
A23527-100UL
500 ul
£1532.00
A23527-500UL
1000 ul
£2704.00
A23527-1000UL
About this Product
- SKU:
- A23527
- Additional Names:
- CD2|LFA-2|Ly-37|Ly37
- Application:
- ELISA, Flow Cytometry, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables identical protein binding activity. Predicted to be involved in T cell activation; heterotypic cell-cell adhesion; and positive regulation of cytokine production. Located in several cellular components, including cell-cell junction; cytoplasmic side of plasma membrane; and external side of plasma membrane. Is anchored component of plasma membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD2 (CD2 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 45-65kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23527
