Histone H3 Rabbit polyclonal antibody
Product Sizes
5 ul
£ POA
A2348-5UL
20 ul
£152.00
A2348-20UL
100 ul
£336.00
A2348-100UL
500 ul
£1258.00
A2348-500UL
1000 ul
£2228.00
A2348-1000UL
About this Product
- SKU:
- A2348
- Additional Names:
- H3.4|H3/g|H3C16|H3FT|H3t|HIST3H3|Histone H3
- Application:
- ELISA, IHC-Paraffin, Immunoprecipitation, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 17 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Other Species, Rat
- Sequence:
- VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A2348
