KCNN3/SK3 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A23419-5UL
20 ul
£164.00
A23419-20UL
100 ul
£342.00
A23419-100UL
500 ul
£1532.00
A23419-500UL
1000 ul
£2704.00
A23419-1000UL
About this Product
- SKU:
- A23419
- Additional Names:
- hSK3|KCa2.3|KCNN3/SK3|SK3|SKCA3|ZLS3
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. This gene belongs to the KCNN family of potassium channels. It encodes an integral membrane protein that forms a voltage-independent calcium-activated channel, which is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. This gene contains two CAG repeat regions in the coding sequence. It was thought that expansion of one or both of these repeats could lead to an increased susceptibility to schizophrenia or bipolar disorder, but studies indicate that this is probably not the case. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 81 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- LSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTSFPTPYTSSSSC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A23419
